diff --git a/ChangeLog b/ChangeLog index 39aa7099..12d9c55a 100644 --- a/ChangeLog +++ b/ChangeLog @@ -1,4 +1,4 @@ -Version 1.0.0 +Version 1.0.0 2020-12-20 * Add README.md files to the output directories documenting the output files Version 0.6.1 2020-10-29 diff --git a/docs/whatsnew.md b/docs/whatsnew.md index 1cde3f04..4add63d8 100644 --- a/docs/whatsnew.md +++ b/docs/whatsnew.md @@ -2,17 +2,15 @@ ## Version 1.0.0 +Released December 21 2020 + ### *User-visible improvements* - Add README.md files to the output directories documenting the output files -## The reference for Macrel is on its way! - -The paper describing Macrel available in [bioRxiv](https://www.biorxiv.org/content/10.1101/2019.12.17.880385v2) is now in press by the PeerJ. - ## Version 0.6.1 -Release October 29 2020 +Released October 29 2020 ### *User-visible improvements* @@ -22,7 +20,7 @@ Release October 29 2020 ## Version 0.6.0 -Release October 10 2020 +Released October 10 2020 ### *User-visible improvements* diff --git a/macrel/macrel_version.py b/macrel/macrel_version.py index 8411e551..1f356cc5 100644 --- a/macrel/macrel_version.py +++ b/macrel/macrel_version.py @@ -1 +1 @@ -__version__ = '0.6.1' +__version__ = '1.0.0' diff --git a/tests/contigs.cluster/expected.prediction b/tests/contigs.cluster/expected.prediction index 85ab6d9c..969684b2 100644 --- a/tests/contigs.cluster/expected.prediction +++ b/tests/contigs.cluster/expected.prediction @@ -1,4 +1,4 @@ -# Prediction from macrel v0.6.1 +# Prediction from macrel v1.0.0 Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability smORF_2 RFLIKMVKVNLMNGKLIRKISLM CLP 0.634 Hemo 0.871 smORF_18 FFNDGKGTIYYGIKKYFRIYF CLP 0.673 Hemo 0.822 diff --git a/tests/contigs.nosmorfs/expected.prediction b/tests/contigs.nosmorfs/expected.prediction index 522891c7..4a000291 100644 --- a/tests/contigs.nosmorfs/expected.prediction +++ b/tests/contigs.nosmorfs/expected.prediction @@ -1,2 +1,2 @@ -# Prediction from macrel v0.6.1 +# Prediction from macrel v1.0.0 Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability diff --git a/tests/contigs/expected.prediction b/tests/contigs/expected.prediction index b17159a5..31d36385 100644 --- a/tests/contigs/expected.prediction +++ b/tests/contigs/expected.prediction @@ -1,4 +1,4 @@ -# Prediction from macrel v0.6.1 +# Prediction from macrel v1.0.0 Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability scaffold75334_1_MH0058_1 RFLIKMVKVNLMNGKLIRKISLM CLP 0.634 Hemo 0.871 scaffold33693_17_MH0058_2 FFNDGKGTIYYGIKKYFRIYF CLP 0.673 Hemo 0.822 diff --git a/tests/peptides/expected.prediction b/tests/peptides/expected.prediction index 300832aa..ad7dd8bc 100644 --- a/tests/peptides/expected.prediction +++ b/tests/peptides/expected.prediction @@ -1,4 +1,4 @@ -# Prediction from macrel v0.6.1 +# Prediction from macrel v1.0.0 Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability AP00002|AMP YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY CLP 0.861 Hemo 0.663 AP00007|AMP GNNRPVYIPQPRPPHPRL CLP 0.970 Hemo 0.515 diff --git a/tests/reads/expected.prediction b/tests/reads/expected.prediction index 06fb2802..0f3852fb 100644 --- a/tests/reads/expected.prediction +++ b/tests/reads/expected.prediction @@ -1,4 +1,4 @@ -# Prediction from macrel v0.6.1 +# Prediction from macrel v1.0.0 Access Sequence AMP_family AMP_probability Hemolytic Hemolytic_probability k77_12_1 RFLIKMVKVNLMNGKLIRKISLM CLP 0.634 Hemo 0.871 k77_15_1 FFNDGKGTIYYGIKKYFRIYF CLP 0.673 Hemo 0.822