You signed in with another tab or window. Reload to refresh your session.You signed out in another tab or window. Reload to refresh your session.You switched accounts on another tab or window. Reload to refresh your session.Dismiss alert
While actions on click are being discussed in #33, there's an additional sanity check this module can run:
chrome.permissions.onAdded.addListener((newPermissions)=>{1.getcurrentactivetabs(oneperwindow)2.checkiftheymatchthenewpermission3.updatetheiricon});// and onRemoved
This handles:
new permissions via webext-domain-permission-toggle
new permissions via other .request() paths
removed permissions via Chrome's UI
HOPEFULLY also permissions removed via "access site on click"
The text was updated successfully, but these errors were encountered:
While actions on click are being discussed in #33, there's an additional sanity check this module can run:
This handles:
webext-domain-permission-toggle
.request()
pathsThe text was updated successfully, but these errors were encountered: