ColabFold / AlphaFold2_advanced on your local PC (or macOS)
To Do: Implementation of command line arguments for runner.py
(Sep.06, 2021)
- Make sure
curl
andwget
commands are already installed on your PC. If not present, you need install them at first. For Ubuntu, typesudo apt -y install curl wget
. - Download
install_colabfold_linux.sh
from this repository:$ wget https://raw.githubusercontent.com/YoshitakaMo/localcolabfold/main/install_colabfold_linux.sh
and run it in the directory where you want to install:$ bash install_colabfold_linux.sh
About 5 minutes later,colabfold
directory will be created. Do not move this directory after the installation. - Type
cd colabfold
to enter the directory. - Modify the variables such as
sequence = 'PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK'
,jobname = "test"
, and etc. inrunner.py
for your prediction. For more information, please refer to the original ColabFold / AlphaFold2_advanced. - To run the prediction, type
$ colabfold-conda/bin/python3.7 runner.py
in thecolabfold
directory. The result files will be created in thepredition_<jobname>_<hash>
in thecolabfold
directory. After the prediction finished, you may move the results from thecolabfold
directory.
Caution: Due to the lack of Nvidia GPU/CUDA driver, the structure prediction on macOS are 5-10 times slower than on Linux+GPU. For the test sequence (58 a.a.), it may take 30 minutes. However, it may be useful to play with it before preparing Linux+GPU environment.
You can check whether your Mac is Intel or Apple Silicon by typing uname -m
on Terminal.
$ uname -m
x86_64 # Intel
arm64 # Apple Silicon
Please use the correct installer for your Mac.
- Install Homebrew if not present:
$ /bin/bash -c "$(curl -fsSL https://raw.githubusercontent.com/Homebrew/install/HEAD/install.sh)"
- Install
wget
command using Homebrew:$ brew install wget
- Download
install_colabfold_intelmac.sh
from this repository:$ wget https://raw.githubusercontent.com/YoshitakaMo/localcolabfold/main/install_colabfold_intelmac.sh
and run it in the directory where you want to install:$ bash install_colabfold_intelmac.sh
About 5 minutes later,colabfold
directory will be created. Do not move this directory after the installation. - The rest procedure is the same as "For Linux".
Note: This installer is experimental because most of the dependent packages are not fully tested on Apple Silicon Mac.
- Install Homebrew if not present:
$ /bin/bash -c "$(curl -fsSL https://raw.githubusercontent.com/Homebrew/install/HEAD/install.sh)"
- Install
wget
andcmake
commands using Homebrew:$ brew install wget cmake
- Install
miniforge
command using Homebrew:$ brew install --cask miniforge
- Download
install_colabfold_M1mac.sh
from this repository:$ wget https://raw.githubusercontent.com/YoshitakaMo/localcolabfold/main/install_colabfold_M1mac.sh
and run it in the directory where you want to install:$ bash install_colabfold_M1mac.sh
About 5 minutes later,colabfold
directory will be created. Do not move this directory after the installation. - Type
cd colabfold
to enter the directory. - Modify the variables such as
sequence = 'PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK'
,jobname = "test"
, and etc. inrunner.py
for your prediction. For more information, please refer to the original ColabFold / AlphaFold2_advanced. - To run the prediction, type
$ colabfold-conda/bin/python3.8 runner.py
in thecolabfold
directory. The result files will be created in thepredition_<jobname>_<hash>
in thecolabfold
directory. After the prediction finished, you may move the results from thecolabfold
directory.
A Warning message appeared when you run the prediction:
You are using an experimental build of OpenMM v7.5.1.
This is NOT SUITABLE for production!
It has not been properly tested on this platform and we cannot guarantee it provides accurate results.
This message is due to Apple Silicon, but I think we can ignore it.
- Structure inference and relaxation will be accelerated if your PC has Nvidia GPU and CUDA drivers.
- No Time out (90 minutes and 12 hours), No GPU limitations.
- You don't need prepare the large database required for native AlphaFold2.
- What else do I need to do before installation? Do I need sudo privileges?
- No, except for installation of
curl
andwget
commands.
- No, except for installation of
- Do I need to prepare the large database such as PDB70, BFD, Uniclust30, MGnify...?
- No. it is not necessary. Generation of MSA is performed by the MMseqs2 web server, just as implemented in ColabFold.
- Are the pLDDT score and PAE figures available?
- Yes, they will be generated just like the ColabFold.
- Is it possible to predict homooligomers and complexes?
- Yes, the sequence input is the same as ColabFold. See ColabFold / AlphaFold2_advanced.
- Is it possible to create MSA by jackhmmer?
- No, it is not currently supported.
- I want to run the predictions step-by-step like Google Colab.
- You can use VSCode and Python plugin to do the same. See https://code.visualstudio.com/docs/python/jupyter-support-py.
- Is this available on Windows 10?
- You can run LocalColabFold on your Windows 10 with WSL2.
- The original colabfold was created by Sergey Ovchinnikov (@sokrypton), Milot Mirdita (@milot_mirdita) and Martin Steinegger (@thesteinegger).
- Mirdita M, Ovchinnikov S and Steinegger M. ColabFold - Making protein folding accessible to all. bioRxiv, doi: 10.1101/2021.08.15.456425 (2021)
I, Yoshitaka Moriwaki, am credited in the acknowlegment of the paper. - John Jumper, Richard Evans, Alexander Pritzel, et al. - Highly accurate protein structure prediction with AlphaFold. Nature, 1–11, doi: 10.1038/s41586-021-03819-2 (2021)